| Basic Information | |
|---|---|
| Taxon OID | 3300002465 Open in IMG/M |
| Scaffold ID | LO132_10231590 Open in IMG/M |
| Source Dataset Name | Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Pennsylvania State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 602 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake → Freshwater Lake Biofilm Microbial Communities From Frasassi Caves, Italy In Anoxic Conditions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Frasassi Caves, Italy | |||||||
| Coordinates | Lat. (o) | 43.3833 | Long. (o) | 12.95 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000763 | Metagenome / Metatranscriptome | 901 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LO132_102315902 | F000763 | AGGTGG | MNIKNPYFIAAGAFLAAWAASNFAADYRSILWAILAGVFGYATPKK* |
| ⦗Top⦘ |