Basic Information | |
---|---|
Taxon OID | 3300002465 Open in IMG/M |
Scaffold ID | LO132_10041645 Open in IMG/M |
Source Dataset Name | Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Pennsylvania State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1891 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake → Freshwater Lake Biofilm Microbial Communities From Frasassi Caves, Italy In Anoxic Conditions |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Frasassi Caves, Italy | |||||||
Coordinates | Lat. (o) | 43.3833 | Long. (o) | 12.95 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006890 | Metagenome | 362 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LO132_100416452 | F006890 | N/A | MTPAQKEIYVVVDEWWKMYGYGPSVDDVMRLTGERGRGNVARKMLALIRLGHCKGMKGVARSIRPSYVRIKNVE* |
⦗Top⦘ |