Scaffold LO132_10011481

Overview

Basic Information

• Taxon OID: 3300002465
• Scaffold ID: LO132_10011481
• Source Dataset Name: Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Pennsylvania State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4004
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake → Freshwater Lake Biofilm Microbial Communities From Frasassi Caves, Italy In Anoxic Conditions

Source Dataset Sampling Location

• Location Name: Frasassi Caves, Italy
• Coordinates
  • Lat. (^o): 43.3833
  • Long. (^o): 12.95

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032237	Metagenome / Metatranscriptome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
LO132_100114817	F032237	N/A	MTEDRFIDKTTSXKTIERVKFKLVPFAKGSKIEISWAFNPEDSMHVDQFLNYDESKNXILIALNGFKKISEKILGAKILSXE*