Basic Information | |
---|---|
Taxon OID | 3300002461 Open in IMG/M |
Scaffold ID | AADWTP_10024809 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from a drinking water treatment plant in Ann Arbor, Michigan, USA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5415 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Freshwater → Freshwater Microbial Communities From A Drinking Water Treatment Plant In Ann Arbor, Michigan, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ann Arbor, Michigan, USA | |||||||
Coordinates | Lat. (o) | 42.296774 | Long. (o) | -83.762994 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F054174 | Metagenome / Metatranscriptome | 140 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
AADWTP_100248096 | F054174 | GGGGG | MAWTDLVAGCFGFGTAPFASNRPDEESAKEAITAAKAEGATRAEFAQLIAMYPRKYMKSDQLLRERIREDAARLDKLWKVPKDSLV* |
⦗Top⦘ |