Scaffold AADWTP_10019903

Overview

Basic Information

• Taxon OID: 3300002461
• Scaffold ID: AADWTP_10019903
• Source Dataset Name: Freshwater microbial communities from a drinking water treatment plant in Ann Arbor, Michigan, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6665
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Freshwater → Freshwater Microbial Communities From A Drinking Water Treatment Plant In Ann Arbor, Michigan, Usa

Source Dataset Sampling Location

• Location Name: Ann Arbor, Michigan, USA
• Coordinates
  • Lat. (^o): 42.296774
  • Long. (^o): -83.762994

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060093	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
AADWTP_100199032	F060093	GGA	MANESYIKTGTALKIQNHNTPDYAWSVEGLTNGAGRVSAQIDLGASPRPGWYRWSCELQLQATPTQGKGVELYKAAADDGTSSRIDGDVGASDAALGDADMRRNLTQFGYVTSENAAASEKCIRSDYFFHPHRYLSLVAYNDSGASVNATASNFLFTLQPFSWQGQ*