| Basic Information | |
|---|---|
| Taxon OID | 3300002461 Open in IMG/M |
| Scaffold ID | AADWTP_10004304 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from a drinking water treatment plant in Ann Arbor, Michigan, USA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 23538 |
| Total Scaffold Genes | 20 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (55.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Freshwater → Freshwater Microbial Communities From A Drinking Water Treatment Plant In Ann Arbor, Michigan, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ann Arbor, Michigan, USA | |||||||
| Coordinates | Lat. (o) | 42.296774 | Long. (o) | -83.762994 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F075009 | Metagenome / Metatranscriptome | 119 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| AADWTP_100043046 | F075009 | GGA | MADDPSTTALARPMIARDLDKAGKGQLVYVGRDGEVKDPAGVRNRQLAAYLAFGGVTAAGVALAATSFPLLIPFYVLLGGRFLGTVRAVRRVNEASVALSNGDSEQGRELAEPVARAWWAPSRVRALAELRLAIADALDGRTEEALTRVRAARAKLSARLIQHQFSYYTEINLLTALGRTKEARVVLDARGGIPAGEVLKLSHWIAELHLCVAEGAIPAGTLPDGELHDRMRKGLSMTAGRDLLLLCAWCYAQLGDHDEARFAWRQAMEREGSQRLEVAMPKLHTWMEEYRKAHPDVDLPEPEDEEFKHL* |
| ⦗Top⦘ |