NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold AADWTP_10004304

Scaffold AADWTP_10004304


Overview

Basic Information
Taxon OID3300002461 Open in IMG/M
Scaffold IDAADWTP_10004304 Open in IMG/M
Source Dataset NameFreshwater microbial communities from a drinking water treatment plant in Ann Arbor, Michigan, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23538
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (55.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Freshwater → Freshwater Microbial Communities From A Drinking Water Treatment Plant In Ann Arbor, Michigan, Usa

Source Dataset Sampling Location
Location NameAnn Arbor, Michigan, USA
CoordinatesLat. (o)42.296774Long. (o)-83.762994Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075009Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
AADWTP_100043046F075009GGAMADDPSTTALARPMIARDLDKAGKGQLVYVGRDGEVKDPAGVRNRQLAAYLAFGGVTAAGVALAATSFPLLIPFYVLLGGRFLGTVRAVRRVNEASVALSNGDSEQGRELAEPVARAWWAPSRVRALAELRLAIADALDGRTEEALTRVRAARAKLSARLIQHQFSYYTEINLLTALGRTKEARVVLDARGGIPAGEVLKLSHWIAELHLCVAEGAIPAGTLPDGELHDRMRKGLSMTAGRDLLLLCAWCYAQLGDHDEARFAWRQAMEREGSQRLEVAMPKLHTWMEEYRKAHPDVDLPEPEDEEFKHL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.