Scaffold JGI24751J29686_10011752

Overview

Basic Information

• Taxon OID: 3300002459
• Scaffold ID: JGI24751J29686_10011752
• Source Dataset Name: Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1805
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: Kellogg Biological Station, Michigan, USA
• Coordinates
  • Lat. (^o): 42.3948
  • Long. (^o): -85.3738

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077359	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24751J29686_100117522	F077359	GGAGG	MRNWAALLLMVTVGCTGCSGGETPPSPEEDAVRDGGIWSPDRGAGIEVLARGRSLPPAHLASAAELRPDAGPGPFSDMRIHVDLSGTVRTVPCAVPSGSYCDGFAVIDLSGATIAVDTYAYLGAKPACRSRWAEGTRVASLSGVWQQRAAGASALSVLALSSCDDLDGAAPAGGSAXPSSDEVHQLVGGWVPGRLVSVHGVVVARWKSSSGAFGLAMQDPDGAASSGVRLVRSRTSTIPASAPEVGDWIRVTARTARDGEHLLEL*