| Basic Information | |
|---|---|
| Taxon OID | 3300002448 Open in IMG/M |
| Scaffold ID | JGIcombinedJ30088_10148159 Open in IMG/M |
| Source Dataset Name | Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by freeze-thaw cycling (Combined Assembly Aplysina symbiont samples, ASSEMBLY_DATE=20140224) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 871 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of Piran, Adriatic Sea | |||||||
| Coordinates | Lat. (o) | 45.5099 | Long. (o) | 13.56 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040284 | Metagenome | 162 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGIcombinedJ30088_101481592 | F040284 | GGAGG | MALFFHSQDVDELVPFPEAVSITEAALKKIGTPEGVNAPRKRLNLHRNVGEAPFDTVLNIYAGGAASYGAVGAQVALHRKAIVGDQQRRPPYNADQTELA |
| ⦗Top⦘ |