| Basic Information | |
|---|---|
| Taxon OID | 3300002447 Open in IMG/M |
| Scaffold ID | JGI24768J34885_10051741 Open in IMG/M |
| Source Dataset Name | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1364 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Lake Ontario | |||||||
| Coordinates | Lat. (o) | 43.933506 | Long. (o) | -78.003845 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001599 | Metagenome / Metatranscriptome | 665 | Y |
| F098902 | Metagenome / Metatranscriptome | 103 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24768J34885_100517411 | F098902 | AGG | MALGKAGSSLTAELNRLAGITNVAQYLDEQGAANRWANTTGMPTVGALNIKA |
| JGI24768J34885_100517412 | F001599 | AGTAGG | MQETVSIAWCDXGMVDGKFMQGVTDVMLKSGVTFATTLRSAGNQIARQRDKVINYWYDNNKSDWLFWVDSDVVVSPDTFNLLWESKDATERPIVSGVYFTTDQPEEPLMTPLPTLFNFVEGDETVGVARIHPMPVNELIKIGAAGMGFVLMHRSVVEKIKEAAPGAPIFSDIGHGKNFLGEDIYFFALCDKADIPVYAHTGATAPHIKRFSFDEHYYNAFFGGVREEQKKSNLIVPKQGLITPTKG* |
| ⦗Top⦘ |