Scaffold JGI24768J34885_10010797

Overview

Basic Information

• Taxon OID: 3300002447
• Scaffold ID: JGI24768J34885_10010797
• Source Dataset Name: Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3018
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: Canada: Lake Ontario
• Coordinates
  • Lat. (^o): 43.933506
  • Long. (^o): -78.003845

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024307	Metagenome	206	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24768J34885_100107971	F024307	AGGAG	MGRPLKIQKSSTGSGNGGAAVGVDLGFPNFGSLTAPVFNSPTQTLDNAQYLGVVGGAGPTDTPSATNPRVDVTVYITGAAAAAQGYIIRQKGAHKYLV