| Basic Information | |
|---|---|
| Taxon OID | 3300002447 Open in IMG/M |
| Scaffold ID | JGI24768J34885_10003439 Open in IMG/M |
| Source Dataset Name | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5159 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (55.56%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Lake Ontario | |||||||
| Coordinates | Lat. (o) | 43.933506 | Long. (o) | -78.003845 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076859 | Metagenome / Metatranscriptome | 117 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24768J34885_100034399 | F076859 | N/A | YGALMELVKNKGVWHESTVSPEYSHLTDDGKDAIIHVVEEMFRGMQTIHNAEVKEEAKKQTMDALR* |
| ⦗Top⦘ |