Scaffold B570J29032_109933944

Overview

Basic Information

• Taxon OID: 3300002408
• Scaffold ID: B570J29032_109933944
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3225
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (14.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.098333
  • Long. (^o): -89.405278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061681	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
B570J29032_1099339443	F061681	N/A	MQDKSIINWELHQKLMAKKRTIKICTGIGLNMFFPEYVTIELQNIDTEIRKPKTSKKNG*