NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold C687J29651_10035769

Scaffold C687J29651_10035769


Overview

Basic Information
Taxon OID3300002407 Open in IMG/M
Scaffold IDC687J29651_10035769 Open in IMG/M
Source Dataset NameSoil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1860
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, Colorado, United States
CoordinatesLat. (o)39.53Long. (o)-107.78Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003037Metagenome / Metatranscriptome511Y
F029069Metagenome / Metatranscriptome189N

Sequences

Protein IDFamilyRBSSequence
C687J29651_100357691F029069GAGVFLDDTPDMQIRDLLMRENMFDESYNIRELLDDIIERVALREKLIQTGKQFSEKKREERFTLATKQFENLMADFLRLYQPVLDRLRNYREGLNKEIQNLKSGLATTNGMLE
C687J29651_100357693F003037GGCGGMWVEFKCPICGKDLDDDREMPNFLVCKDESHGVLRFFTGDGCFFTTSEKVAEELTNKGKRVHVVDPKQFFGLQLEK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.