Scaffold B570J29610_1020241

Overview

Basic Information

• Taxon OID: 3300002399
• Scaffold ID: B570J29610_1020241
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - 07JUL2009 deep hole epilimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 535
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Acalyptratae → Ephydroidea → Drosophilidae → Drosophilinae → Drosophilini → Drosophila → Sophophora → melanogaster group → melanogaster subgroup → Drosophila yakuba (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.098333
  • Long. (^o): -89.405278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022143	Metagenome / Metatranscriptome	215	Y

Sequences

Protein ID	Family	RBS	Sequence
B570J29610_10202411	F022143	N/A	EGVPHEAVPTKQAAAQPAATAEEESAQTKPTRVPTGESSCSSDPEQITGMGVIVGSLRTTPVDQWTCKVPACTGKFHRLKDCRRFHKMEPEERLKLVDLHGLCLGCLTPGHGRAARNCPYEEERADVCRKAPCRRRHHQLLHVDEHKARKGPEKDSLTRAPSPHEDPTPTEDSGHEVQ