Scaffold JGI24501J29690_1066466

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24501J29690_1066466

Scaffold JGI24501J29690_1066466

Overview

Basic Information
Taxon OID	3300002391 Open in IMG/M
Scaffold ID	JGI24501J29690_1066466 Open in IMG/M
Source Dataset Name	Biogas fermentation microbial communities from Germany - Plant 2 RNA2 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	766
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location
Location Name	Bielefeld, North Rhine-Westphalia, Germany
Coordinates	Lat. (^o)	52.0385	Long. (^o)	8.4956	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054061	Metagenome / Metatranscriptome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24501J29690_10664664	F054061	AGGAG	MDDEWYEIIKAGPADAPPEQALYHIQQTYPDGSGGRLNVDWDGLLRLHELIQERIGAE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.