Scaffold JGI24500J29687_10081652

Overview

Basic Information

• Taxon OID: 3300002377
• Scaffold ID: JGI24500J29687_10081652
• Source Dataset Name: Biogas fermentation microbial communities from Germany - Plant 2 RNA1 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1293
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location

• Location Name: Bielefeld, North Rhine-Westphalia, Germany
• Coordinates
  • Lat. (^o): 52.0385
  • Long. (^o): 8.4956
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032286	Metagenome / Metatranscriptome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24500J29687_100816521	F032286	N/A	GSTFRFCRLMCLCVKRRNIILNSKRRSLLNSTLFRADNHTRQKAISPFSLALIFTFDFAALSERRSCPEDRSRRFVLLGALDAALRRRTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAPKNADFHAYGQDWKRAGI*