| Basic Information | |
|---|---|
| Taxon OID | 3300002376 Open in IMG/M |
| Scaffold ID | JGI24505J29691_1046235 Open in IMG/M |
| Source Dataset Name | Biogas fermentation microbial communities from Germany - Plant 4 RNA2 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1730 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bielefeld, North Rhine-Westphalia, Germany | |||||||
| Coordinates | Lat. (o) | 52.0385 | Long. (o) | 8.4956 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014003 | Metagenome / Metatranscriptome | 266 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24505J29691_10462351 | F014003 | N/A | FDVNRGIMKSNKTTAMSGERRMKTMKTVYNKTKVKSWIKKAQKSSLFAYGHGYITDGKVMLVDEPHMHPTILEIFGTLTPECKYSAEAFQKLMNLPDEPVKLIDSQLEYTPDPKSRLRIFYDPKTGKELAIDGKYFDLLDNPKVHKFCTNDIMNRLWIMHDDGVVGVVAPVMLREELSHIRFKAENELN* |
| ⦗Top⦘ |