Scaffold B570J29583_1001045

Overview

Basic Information

• Taxon OID: 3300002350
• Scaffold ID: B570J29583_1001045
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2241
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.098333
  • Long. (^o): -89.405278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033009	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
B570J29583_10010456	F033009	N/A	QLWWAGTITQFGDMQKFYDVNLWTMESKDGSYASVILDGEMIKSFRCEGAWDLARKLAESHLLKREQLEQEGWVTA*