| Basic Information | |
|---|---|
| Taxon OID | 3300002343 Open in IMG/M |
| Scaffold ID | JGI24214J29971_1028305 Open in IMG/M |
| Source Dataset Name | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - F_92min_Anaerobic (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 508 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Madison, WI, USA | |||||||
| Coordinates | Lat. (o) | 43.078418 | Long. (o) | -89.386482 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038054 | Metagenome / Metatranscriptome | 166 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24214J29971_10283051 | F038054 | N/A | MSSLFNPNYFQAILNLISGRSTTLATLWGMFWQAAYALIGCVLGAAVFGNFGALIGTVIGAWLGYRAVNPYHSLISQLNELNDRQKHNLAEEIRRTVGSSNVDNLLRYATNGNGRQLIFDLIQRFMLNNQPQPANVNANFFSRLFSS* |
| ⦗Top⦘ |