Scaffold JGI24214J29971_1005579

Overview

Basic Information

• Taxon OID: 3300002343
• Scaffold ID: JGI24214J29971_1005579
• Source Dataset Name: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - F_92min_Anaerobic (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1946
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Source Dataset Sampling Location

• Location Name: Madison, WI, USA
• Coordinates
  • Lat. (^o): 43.078418
  • Long. (^o): -89.386482

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010229	Metagenome / Metatranscriptome	306	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24214J29971_10055791	F010229	GAG	MLPALRSTTNINRVLTQTLGVLRQHQAFRVPVQHSSAVSVLTDEQRALNLKIWPGVPETVRPMAIDYCPIDPVEFDRLTDRFDPQVNMWKWLSLLVAIPAVALLTYLNLIVPQDHTRPEFKDWDHLRPRMKWPIKDGEHSPFHSKWFNAIHYDGKGYETSDAEFEKHFHHGHH*