Scaffold JGI24211J29976_10428

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24211J29976_10428

Scaffold JGI24211J29976_10428

Overview

Basic Information
Taxon OID	3300002338 Open in IMG/M
Scaffold ID	JGI24211J29976_10428 Open in IMG/M
Source Dataset Name	Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - N_134min_Aerobic no depletion (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	702
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Source Dataset Sampling Location
Location Name	Madison, WI, USA
Coordinates	Lat. (^o)	43.078418	Long. (^o)	-89.386482	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030134	Metagenome / Metatranscriptome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24211J29976_104281	F030134	N/A	SFRTKMQTIYLKDKIQPVLQRFKLRSCNLSTVEQTDSLSYILVDKIIQHRGSNHVYR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.