| Basic Information | |
|---|---|
| Taxon OID | 3300002308 Open in IMG/M |
| Scaffold ID | JGI20171J29575_12256158 Open in IMG/M |
| Source Dataset Name | Nasutitermes corniger P4 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 951 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | laboratory colony in Florida, USA | |||||||
| Coordinates | Lat. (o) | 26.0625 | Long. (o) | -80.2332 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033096 | Metagenome | 178 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI20171J29575_122561582 | F033096 | N/A | GKSPNMGRCIISYQEVLSSLLKNVNHQADAADPCNHSINGQLLRTSVLTGRLYFGAL* |
| ⦗Top⦘ |