NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24891J29808_1003595

Scaffold JGI24891J29808_1003595


Overview

Basic Information
Taxon OID3300002301 Open in IMG/M
Scaffold IDJGI24891J29808_1003595 Open in IMG/M
Source Dataset NameLentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI co-culture FSW-F8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1898
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany

Source Dataset Sampling Location
Location NameBrandenburg, Germany
CoordinatesLat. (o)53.1666Long. (o)13.0333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089761Metagenome108Y

Sequences

Protein IDFamilyRBSSequence
JGI24891J29808_10035952F089761N/AMSMRYPDNEFTKPSIMLLRSLANTLGLDASKDPGGYGGLKMERQRLTDKLKQNLGDARLSDWDRDMIKGLE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.