NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24891J29808_1001316

Scaffold JGI24891J29808_1001316


Overview

Basic Information
Taxon OID3300002301 Open in IMG/M
Scaffold IDJGI24891J29808_1001316 Open in IMG/M
Source Dataset NameLentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI co-culture FSW-F8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5104
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany

Source Dataset Sampling Location
Location NameBrandenburg, Germany
CoordinatesLat. (o)53.1666Long. (o)13.0333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051715Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
JGI24891J29808_10013163F051715N/AVLEGNKRHEAFTYPDEEWYYFKFADRFGWTPEQVDNLPAGRSDWLLSIADTVERVKIKQIEKSNGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.