Scaffold B570J29579_100541

Overview

Basic Information

• Taxon OID: 3300002272
• Scaffold ID: B570J29579_100541
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2696
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (63.64%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.098333
  • Long. (^o): -89.405278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008236	Metagenome / Metatranscriptome	336	Y

Sequences

Protein ID	Family	RBS	Sequence
B570J29579_10054111	F008236	N/A	RLVSLEKYMNVYASVHDDKDMGEAMAQGFKLFAWCDSDMKIAPKRPKSKVKAEAWRKALPKLVVLNGAKFVTCPEIRRGRSVITCTGTKDSISCDMCVKGLANVLFPAH*