NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J29578_1001685

Scaffold B570J29578_1001685


Overview

Basic Information
Taxon OID3300002271 Open in IMG/M
Scaffold IDB570J29578_1001685 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 13JUN2011 deep hole epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1666
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018505Metagenome / Metatranscriptome234Y
F022594Metagenome / Metatranscriptome213Y

Sequences

Protein IDFamilyRBSSequence
B570J29578_10016851F022594N/AMRFKKIIIRKAHDILPSHLAGGMDASEGTYVWDHIQRGCSGGEWEELYKGKLGILKGEVITLDQSAGQRAWLKLGEVVTICGKRMRSTHLRRVYVRWTRPQRIREVITTHPTSREEKELEGMRLEWSYQRGRDSYMIRRELREAATGGCWTRGTLAELRQSQAAGTGGARSAAAHFGVGHLAVRSGGVVYIARCRMVVVELRNHTYCTQEIPVMHRGEELYVDPLSLVVQRSATPVKCRKRTPPRWKIGKSWFCGYPEIRPCNGPGPLPEHRCTNIRREGIDMEAESEGDVQDRYPEGGRHHNLSCEALERLSLDIXKRWLGGXEGLEVVPGXVGTAMLGVSIIEMTLSTIVRMSALYAWKGPG
B570J29578_10016852F018505N/APLSREAAACISQVIVALTLLLANAGSADGFIAYSCEDMRSPVVSYDLTPQAGCWMRPLSHGGLEQKDGRILWMRDKAQFPVIHCKMVETVMRAGCGPGNDTGPWEMIEIEKLVPITPRDCLXAFVAGRVTLLGHTVDLTGNGTGMKTLEERVNCGRQGQGSARGSPEGPGRPHIQLTIRRIAVWKRMATEDAIQEDHHKKSP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.