| Basic Information | |
|---|---|
| Taxon OID | 3300002259 Open in IMG/M |
| Scaffold ID | meta401DRAFT_123737 Open in IMG/M |
| Source Dataset Name | Muck sample |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 718 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Petroleum Byproduct → Petroleum Byproduct Microbial Communities From Gujarat, India |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | 23.03142 | Long. (o) | 70.21517 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037780 | Metagenome / Metatranscriptome | 167 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| meta401DRAFT_1237372 | F037780 | N/A | GSAASGRPEGGDDDGTTPMQKSDLLIVARRPVKAGRAKEEMD* |
| ⦗Top⦘ |