Basic Information | |
---|---|
Taxon OID | 3300002245 Open in IMG/M |
Scaffold ID | JGIcombinedJ26739_100080206 Open in IMG/M |
Source Dataset Name | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3028 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Algoma, Ontario, Canada | |||||||
Coordinates | Lat. (o) | 46.42 | Long. (o) | -83.37 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002523 | Metagenome / Metatranscriptome | 552 | Y |
F011898 | Metagenome / Metatranscriptome | 286 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGIcombinedJ26739_1000802061 | F002523 | N/A | MLVIVSVSRLVDDRVEIRVAKPQHHSNAAQTYASEKEARAVLLGFGISPEAIDLHLKLLPQLGANERLNFPPMDVPQDELLSNGFRV* |
JGIcombinedJ26739_1000802063 | F011898 | GGAG | MAKTMPLGSMRLRLESGEDSPAKEYRIEDGKVEVRTLDADGGSVRRTGSVWWQLTPEQLSIHVERNTVVAQWLERRLGWRRLLQACVGQEPTVWKAAENTSHPAL* |
⦗Top⦘ |