Scaffold JGIcombinedJ26739_100008681

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGIcombinedJ26739_100008681

Scaffold JGIcombinedJ26739_100008681

Overview

Basic Information
Taxon OID	3300002245 Open in IMG/M
Scaffold ID	JGIcombinedJ26739_100008681 Open in IMG/M
Source Dataset Name	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8121
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (72.73%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location Name	Algoma, Ontario, Canada
Coordinates	Lat. (^o)	46.42	Long. (^o)	-83.37	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011878	Metagenome / Metatranscriptome	286	Y

Sequences

Protein ID	Family	RBS	Sequence
JGIcombinedJ26739_1000086815	F011878	GGGGG	MGRRVVMDDHVVEATPVYVRQEARLRLEEISEGMEGIPPDSAFWASIRVSRLCVVVRGWSFFYTCDGEKLRVTEVRGK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.