NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold KVRMV2_101548957

Scaffold KVRMV2_101548957


Overview

Basic Information
Taxon OID3300002231 Open in IMG/M
Scaffold IDKVRMV2_101548957 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Santorini caldera mats, Greece - red mat
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)716
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Hellenic Volcanic Arc

Source Dataset Sampling Location
Location NameSantorini caldera, Greece
CoordinatesLat. (o)36.5Long. (o)25.45Alt. (m)Depth (m)336
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081207Metagenome114Y

Sequences

Protein IDFamilyRBSSequence
KVRMV2_1015489571F081207N/AKETYKKEIKSLRRLLDDNEYTRTLPSGLHSFISDMHRKLVGNSKITPKMLSAIQTAVATYETYGNPNTKKKRDSMLAKITKLKYLLTKCGYTRQYEYEKMEFLDSITKRVHSKGALTPKQAKYANALYKQFNKRILP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.