Basic Information | |
---|---|
Taxon OID | 3300002231 Open in IMG/M |
Scaffold ID | KVRMV2_100496418 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2370 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (42.86%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Hellenic Volcanic Arc |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Santorini caldera, Greece | |||||||
Coordinates | Lat. (o) | 36.5 | Long. (o) | 25.45 | Alt. (m) | Depth (m) | 336 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031512 | Metagenome / Metatranscriptome | 182 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
KVRMV2_1004964182 | F031512 | GAG | MNEQMRKLVGSLDKTHKEFVSKVVSSGGINLEASKLGREYKDIQREMIIVDIVDKKEKY* |
⦗Top⦘ |