| Basic Information | |
|---|---|
| Taxon OID | 3300002231 Open in IMG/M |
| Scaffold ID | KVRMV2_100028014 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2149 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Hellenic Volcanic Arc |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Santorini caldera, Greece | |||||||
| Coordinates | Lat. (o) | 36.5 | Long. (o) | 25.45 | Alt. (m) | Depth (m) | 336 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051542 | Metagenome | 144 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| KVRMV2_1000280143 | F051542 | AGG | MKIILIISLLLFAGCSAKFDGFDPTTSVVKWVLTNDR* |
| ⦗Top⦘ |