Scaffold M1t2FKB2103N_1771928

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold M1t2FKB2103N_1771928

Scaffold M1t2FKB2103N_1771928

Overview

Basic Information
Taxon OID	3300002230 Open in IMG/M
Scaffold ID	M1t2FKB2103N_1771928 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Baltic Sea - M1t2 FKB2 (103N)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Karolinska Institutet
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8625
Total Scaffold Genes	21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	17 (80.95%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	58.133	Long. (^o)	10.0	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078575	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
M1t2FKB2103N_177192815	F078575	AGG	MTTLNVHFVNRGYGTDEGFKKVELLGQGICEHTGKPVAEIASPFGLGGTLVAEYEGTAGGWVCDLD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.