| Basic Information | |
|---|---|
| Taxon OID | 3300002229 Open in IMG/M |
| Scaffold ID | S2T2FKBb102_1934141 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Baltic Sea - S2t7 FKBb (102N) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Karolinska Institutet |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2047 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baltic Sea | |||||||
| Coordinates | Lat. (o) | 57.305 | Long. (o) | 20.074 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059986 | Metagenome / Metatranscriptome | 133 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| S2T2FKBb102_19341413 | F059986 | GGAG | MTLMDALILLGLILIIFGCIFYIIATIMIRHYDQKLWELDNKLKQDEKWRKEYKR* |
| ⦗Top⦘ |