Scaffold S2T2FKBb102_1174660

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold S2T2FKBb102_1174660

Scaffold S2T2FKBb102_1174660

Overview

Basic Information
Taxon OID	3300002229 Open in IMG/M
Scaffold ID	S2T2FKBb102_1174660 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Baltic Sea - S2t7 FKBb (102N)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Karolinska Institutet
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	907
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	57.305	Long. (^o)	20.074	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020114	Metagenome / Metatranscriptome	226	Y

Sequences

Protein ID	Family	RBS	Sequence
S2T2FKBb102_11746601	F020114	GGAG	MTMKPQTFKHISRCIDKHGVHHLDALDDYGRHWYATMQQKEEPWLTYIQKWELRTH*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.