NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24723J26617_10074690

Scaffold JGI24723J26617_10074690


Overview

Basic Information
Taxon OID3300002225 Open in IMG/M
Scaffold IDJGI24723J26617_10074690 Open in IMG/M
Source Dataset NameOil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1076
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps

Source Dataset Sampling Location
Location NameCoal Oil Point, Santa Barbara, CA
CoordinatesLat. (o)34.39225Long. (o)-119.845662Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048322Metagenome148Y

Sequences

Protein IDFamilyRBSSequence
JGI24723J26617_100746902F048322GAGMRYTKSLMLWCLQKMQEYWWYVEAFCKRPERKESVQIAGENRSI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.