| Basic Information | |
|---|---|
| Taxon OID | 3300002225 Open in IMG/M |
| Scaffold ID | JGI24723J26617_10012185 Open in IMG/M |
| Source Dataset Name | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4452 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (62.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Coal Oil Point, Santa Barbara, CA | |||||||
| Coordinates | Lat. (o) | 34.39225 | Long. (o) | -119.845662 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F103884 | Metagenome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24723J26617_100121853 | F103884 | N/A | MIVKETTDLDEIKAVLCDPAIYDTITDDNSGLIEDFKPTLEDHLYVGGYVNGEIVALMVYHKYLDGNKCHVQVLPEFRKEYALKFGEQSLLFRGTLPLYAVIPDLYKNVLEFSFLFGFKTIDKTENTYVKNGKSYNDNILRL* |
| ⦗Top⦘ |