| Basic Information | |
|---|---|
| Taxon OID | 3300002201 Open in IMG/M |
| Scaffold ID | metazooDRAFT_1271118 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 774 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake → Freshwater Microbial Community From Sao Paulo Zoo Lake, Brazil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sao Paulo, Brazil | |||||||
| Coordinates | Lat. (o) | -23.651072 | Long. (o) | -46.620675 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036199 | Metagenome | 170 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| metazooDRAFT_12711182 | F036199 | AGG | MIVDTINYKAVWTWINAVWAKSFVAIVLFLIGLWIGNVQTEGRIAGDCKFAGAFRVDIQAFSCQRKI* |
| ⦗Top⦘ |