NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold metazooDRAFT_1189970

Scaffold metazooDRAFT_1189970


Overview

Basic Information
Taxon OID3300002196 Open in IMG/M
Scaffold IDmetazooDRAFT_1189970 Open in IMG/M
Source Dataset NameCompost microbial communities from Sao Paulo Zoo, Brazil - ZC3b day 99
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Sao Paulo, Virginia Bioinformatics Institute
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)522
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Source Dataset Sampling Location
Location NameSao Paulo Zoo, Brazil
CoordinatesLat. (o)-23.651072Long. (o)-46.620675Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088555Metagenome109N

Sequences

Protein IDFamilyRBSSequence
metazooDRAFT_11899702F088555GGAGGMALRMYFDETVSSLVRDDISPTLGSPDTYEGPGAGGTVERKLYIYSDNFQRTYSQVQLTSLNADAQVQLHYALDDNGSPGTWQTTVDLPDGDYRTPYPIWVRVTFAPTDEPTLRTDLRHWLQWLE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.