Basic Information | |
---|---|
Taxon OID | 3300002191 Open in IMG/M |
Scaffold ID | LCLV3ORF_1018050 Open in IMG/M |
Source Dataset Name | LCL_V3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 517 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Red Sea | |||||||
Coordinates | Lat. (o) | 21.34383 | Long. (o) | 38.07683 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068204 | Metagenome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LCLV3ORF_10180502 | F068204 | AGGAGG | VRLAYKFLIALGIAFVILFGVPTGVALAKGNSEALRGLIQTLKYILKAHKETIGAMVKAYVKFTLFLLILKQNPRY |
⦗Top⦘ |