Scaffold LCLV3ORF_1005443

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LCLV3ORF_1005443

Scaffold LCLV3ORF_1005443

Overview

Basic Information
Taxon OID	3300002191 Open in IMG/M
Scaffold ID	LCLV3ORF_1005443 Open in IMG/M
Source Dataset Name	LCL_V3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1575
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea

Source Dataset Sampling Location
Location Name	Red Sea
Coordinates	Lat. (^o)	21.34383	Long. (^o)	38.07683	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041254	Metagenome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
LCLV3ORF_10054432	F041254	GGAG	MEKTTKLTKDEYLESLDPDNLNLEKKDLINFCYKCINEWKNNKIGNFKYIVAMELMIGAVRITPEDVMKTV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.