NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LCLV3ORF_1005365

Scaffold LCLV3ORF_1005365


Overview

Basic Information
Taxon OID3300002191 Open in IMG/M
Scaffold IDLCLV3ORF_1005365 Open in IMG/M
Source Dataset NameLCL_V3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1596
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea

Source Dataset Sampling Location
Location NameRed Sea
CoordinatesLat. (o)21.34383Long. (o)38.07683Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052244Metagenome143Y

Sequences

Protein IDFamilyRBSSequence
LCLV3ORF_10053653F052244AGGAGGMKEKLRTEIYLLLLTLILVLAVGIITFYIVAGTWARIDRGLDQIDNMLACIKGCPP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.