| Basic Information | |
|---|---|
| Taxon OID | 3300002191 Open in IMG/M |
| Scaffold ID | LCLV3ORF_1001094 Open in IMG/M |
| Source Dataset Name | LCL_V3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4684 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Halorubraceae → Halorubrum → Halorubrum vacuolatum | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Red Sea | |||||||
| Coordinates | Lat. (o) | 21.34383 | Long. (o) | 38.07683 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F106033 | Metagenome | 100 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LCLV3ORF_10010941 | F106033 | N/A | ASKYALLECNIDNDHDDVEISGHPDFVHHDSGEQFSWDGWTSVVFITDLRHDGDFGLKLKSTDNDIIPFRVRGDTAERILSEVTAIYFNNSGTSGTNFLLLEGY* |
| ⦗Top⦘ |