Scaffold JGI24539J26755_10096929

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24539J26755_10096929

Scaffold JGI24539J26755_10096929

Overview

Basic Information
Taxon OID	3300002186 Open in IMG/M
Scaffold ID	JGI24539J26755_10096929 Open in IMG/M
Source Dataset Name	Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	857
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location Name	Norwegian Sea, Atlantic Ocean
Coordinates	Lat. (^o)	71.2008	Long. (^o)	8.8666	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076515	Metagenome / Metatranscriptome	118	N

Sequences

Protein ID	Family	RBS	Sequence
JGI24539J26755_100969292	F076515	N/A	MITIMFTGYSVSDEYIQNKRVDVEDVFLQYYPDVDIETLINKEEEEFEFIYKGEWSSPEDIDEDVIRDICQSNELYCHILIDNKINKSYYYDEDDEFVYK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.