| Basic Information | |
|---|---|
| Taxon OID | 3300002181 Open in IMG/M |
| Scaffold ID | JGI24670J26820_11233064 Open in IMG/M |
| Source Dataset Name | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 538 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Zanca-sant'andrea, Tuscany, Italy | |||||||
| Coordinates | Lat. (o) | 42.8072 | Long. (o) | 10.1411 | Alt. (m) | Depth (m) | 6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040379 | Metagenome | 162 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24670J26820_112330642 | F040379 | GGAG | MTFLTRNFDPLIPLAPKFPNFAIQTLLFRLKHTVAVVTHAHVLQHFYTTWVLRVACQKQRLGPKWEGAGLGQHQKNWDPLHISATVEASNFKFGTQLGFGTSLPKSDV* |
| ⦗Top⦘ |