Scaffold JGI24820J26691_1004749

Overview

Basic Information

• Taxon OID: 3300002176
• Scaffold ID: JGI24820J26691_1004749
• Source Dataset Name: Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3847
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 0.0
  • Long. (^o): -158.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059059	Metagenome / Metatranscriptome	134	N

Sequences

Protein ID	Family	RBS	Sequence
JGI24820J26691_10047495	F059059	GGAG	MPQLTETEINIRKQTLESDLQTVKDSLNKLDSERTNLVAQHHAISGAIQQCDLFLNDLKVVSETTDSSIPKKKG*