NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24820J26691_1002791

Scaffold JGI24820J26691_1002791


Overview

Basic Information
Taxon OID3300002176 Open in IMG/M
Scaffold IDJGI24820J26691_1002791 Open in IMG/M
Source Dataset NameMarine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5124
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (36.36%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)0.0Long. (o)-158.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041260Metagenome160N

Sequences

Protein IDFamilyRBSSequence
JGI24820J26691_10027912F041260N/AMTCRSAVLIDDFLSQSDFNSISSRVALSPQYFSPHHHDTRDDLWKDVNHLVFKRMKEVKIYQPHFEEATKIANFSHNQYRPPNYGHGNFNGPHVDTGSYVFYIHPHWDEEWEGKIKFTKAVEEEYRNGIFAKPNRFIWIQDNIYHDVTTTSPHAQHSRVTNLGFLGGHLYGDPVGTDFINIFTEM*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.