Basic Information | |
---|---|
Taxon OID | 3300002175 Open in IMG/M |
Scaffold ID | JGI20166J26741_12279606 Open in IMG/M |
Source Dataset Name | Cubitermes ugandensis P5 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P5 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 580 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kakamega Forest, Kenya | |||||||
Coordinates | Lat. (o) | 0.2917 | Long. (o) | 34.856 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010405 | Metagenome | 304 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI20166J26741_122796061 | F010405 | N/A | LLLQKHLTSGTELILIGWKIVPNEEHVQCDRRFTSQPLANEPLHSSQLFDISLQTARGTTSLCGP* |
⦗Top⦘ |