Scaffold JGI24709J26583_10091704

Overview

Basic Information

• Taxon OID: 3300002173
• Scaffold ID: JGI24709J26583_10091704
• Source Dataset Name: Biogas fermentation microbial communities from Germany - Plant 2 DNA1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1010
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location

• Location Name: Bielefeld, North Rhine-Westphalia, Germany
• Coordinates
  • Lat. (^o): 52.0385
  • Long. (^o): 8.4956
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084407	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
JGI24709J26583_100917043	F084407	AGGAGG	MPTSGNVLALLPVLTPYTPTSAQFDLLYPYALDEFEGDDPGCSKTGAERALAYLMAHYLAGGEDQIGFSGEKIDDYSYTVAGPAXTSSRWYVLYRQQLDRCRDARAISPAGLTGVQHADATGLKDLHLDQNPVVRVRGDSDEST*