NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24707J26582_10072395

Scaffold JGI24707J26582_10072395


Overview

Basic Information
Taxon OID3300002163 Open in IMG/M
Scaffold IDJGI24707J26582_10072395 Open in IMG/M
Source Dataset NameBiogas fermentation microbial communities from Germany - Plant 1 DNA1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1138
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location
Location NameBielefeld, North Rhine-Westphalia, Germany
CoordinatesLat. (o)52.0385Long. (o)8.4956Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014003Metagenome / Metatranscriptome266Y

Sequences

Protein IDFamilyRBSSequence
JGI24707J26582_100723952F014003AGGAGGMQTVFNKAKVKSWIKKAQKSSLFAYGHGYITDGYAMLVDEPHMRPTILEVFGTLTPECKHSAEQFKRLMRLPNKPIEVIDSRLEFILEPKRQLRXLYDPKTGKEXTLNXMYFDLLNNPEACTXHTNELMSMLWIVYDNETVGVIAPYRLEDQLSHVSFKVEEREQV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.